SCOPe 2.05: Domain d1sy7a1: 1sy7 A:553-736

Lineage for d1sy7a1 (1sy7 A:553-736)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (2 species)

7. Species Fungus (Neurospora crassa) [TaxId:5141] [117483] (1 PDB entry)
   Uniprot Q9C168 68-765

8. Domain d1sy7a1: 1sy7 A:553-736 [112161]
   complexed with hdd, hem

Details for d1sy7a1

PDB Entry: 1sy7, 1.75 Å

PDB Description: crystal structure of the catalase-1 from neurospora crassa, native structure at 1.75a resolution.

PDB Compounds: (A:) Catalase 1

SCOPe Domain Sequences for d1sy7a1:

Sequence; same for both SEQRES and ATOM records:

>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Fungus (Neurospora crassa) [TaxId: 5141]}
iksrrvaiiiadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegf
rstmvdaifipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvt
vsseaevhesygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhs
miay

Timeline for d1sy7a1:

• d1sy7a1 first appeared in SCOP 1.71
  
• d1sy7a1 appears in SCOPe 2.04
  
• d1sy7a1 appears in SCOPe 2.06
  
• d1sy7a1 appears in the current release, SCOPe 2.08