![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
![]() | Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
![]() | Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
![]() | Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
![]() | Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries) Uniprot O69250 |
![]() | Domain d1rzrs_: 1rzr S: [111998] Other proteins in same PDB: d1rzra1, d1rzra2, d1rzrc1, d1rzrc2, d1rzrd1, d1rzrd2, d1rzrg1, d1rzrg2 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 1rzr (more details), 2.8 Å
SCOPe Domain Sequences for d1rzrs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzrs_ d.94.1.1 (S:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]} aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati tisaegsdeadalaaledtmskeglge
Timeline for d1rzrs_: