PDB entry 1rzr

View 1rzr on RCSB PDB site
Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
Class: transcription/transport protein/DNA
Keywords: protein-DNA complex, phospho-protein, transcription/transport protein/DNA COMPLEX
Deposited on 2003-12-27, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • modified residue (0)
      • modified residue (15)
      • modified residue (87)
      • modified residue (111)
      • modified residue (122)
      • modified residue (249)
      • modified residue (281)
      • modified residue (293)
      • modified residue (301)
      • modified residue (308)
    Domains in SCOPe 2.07: d1rzra1, d1rzra2
  • Chain 'B':
    Compound: 5'-d(*cp*tp*gp*tp*tp*ap*gp*cp*gp*cp*tp*tp*tp*cp*ap*g)-3'
  • Chain 'C':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • modified residue (0)
      • modified residue (15)
      • modified residue (87)
      • modified residue (111)
      • modified residue (122)
      • modified residue (249)
      • modified residue (281)
      • modified residue (293)
      • modified residue (301)
      • modified residue (308)
    Domains in SCOPe 2.07: d1rzrc1, d1rzrc2
  • Chain 'D':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • modified residue (15)
      • modified residue (87)
      • modified residue (111)
      • modified residue (122)
      • modified residue (249)
      • modified residue (281)
      • modified residue (293)
      • modified residue (301)
      • modified residue (308)
    Domains in SCOPe 2.07: d1rzrd1, d1rzrd2
  • Chain 'E':
    Compound: 5'-d(*cp*tp*gp*ap*ap*ap*gp*cp*gp*cp*tp*ap*ap*cp*ap*g)-3'
  • Chain 'G':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • modified residue (0)
      • modified residue (15)
      • modified residue (87)
      • modified residue (111)
      • modified residue (122)
      • modified residue (249)
      • modified residue (281)
      • modified residue (293)
      • modified residue (301)
      • modified residue (308)
    Domains in SCOPe 2.07: d1rzrg1, d1rzrg2
  • Chain 'H':
    Compound: 5'-d(*cp*tp*gp*ap*ap*ap*gp*cp*gp*cp*tp*ap*ap*cp*ap*g)-3'
  • Chain 'L':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium [TaxId:1404]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOPe 2.07: d1rzrl_
  • Chain 'R':
    Compound: 5'-d(*cp*tp*gp*tp*tp*ap*gp*cp*gp*cp*tp*tp*tp*cp*ap*g)-3'
  • Chain 'S':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium [TaxId:1404]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOPe 2.07: d1rzrs_
  • Chain 'T':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium [TaxId:1404]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOPe 2.07: d1rzrt_
  • Chain 'Y':
    Compound: Phosphocarrier protein HPr
    Species: Bacillus megaterium [TaxId:1404]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69250 (Start-87)
      • modified residue (45)
    Domains in SCOPe 2.07: d1rzry_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrA (A:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrC (C:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrD (D:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrG (G:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rzrL (L:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrL (L:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1rzrS (S:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrS (S:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1rzrT (T:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrT (T:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1rzrY (Y:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrY (Y:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge