Lineage for d1rzrl_ (1rzr L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965931Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
    Uniprot O69250
  8. 2965933Domain d1rzrl_: 1rzr L: [111997]
    Other proteins in same PDB: d1rzra1, d1rzra2, d1rzrc1, d1rzrc2, d1rzrd1, d1rzrd2, d1rzrg1, d1rzrg2
    protein/DNA complex; complexed with mg, so4

Details for d1rzrl_

PDB Entry: 1rzr (more details), 2.8 Å

PDB Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
PDB Compounds: (L:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1rzrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzrl_ d.94.1.1 (L:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

SCOPe Domain Coordinates for d1rzrl_:

Click to download the PDB-style file with coordinates for d1rzrl_.
(The format of our PDB-style files is described here.)

Timeline for d1rzrl_: