Lineage for d1rzrc2 (1rzr C:61-332)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2912965Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 2912966Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 2912991Domain d1rzrc2: 1rzr C:61-332 [111992]
    Other proteins in same PDB: d1rzra1, d1rzrc1, d1rzrd1, d1rzrg1, d1rzrl_, d1rzrs_, d1rzrt_, d1rzry_
    protein/DNA complex; complexed with mg, so4

Details for d1rzrc2

PDB Entry: 1rzr (more details), 2.8 Å

PDB Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
PDB Compounds: (C:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1rzrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzrc2 c.93.1.1 (C:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d1rzrc2:

Click to download the PDB-style file with coordinates for d1rzrc2.
(The format of our PDB-style files is described here.)

Timeline for d1rzrc2: