Lineage for d1rzrt_ (1rzr T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2531039Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2531040Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2531057Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2531058Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
    Uniprot O69250
  8. 2531062Domain d1rzrt_: 1rzr T: [111999]
    Other proteins in same PDB: d1rzra1, d1rzra2, d1rzrc1, d1rzrc2, d1rzrd1, d1rzrd2, d1rzrg1, d1rzrg2
    protein/DNA complex; complexed with mg, so4

Details for d1rzrt_

PDB Entry: 1rzr (more details), 2.8 Å

PDB Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
PDB Compounds: (T:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1rzrt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzrt_ d.94.1.1 (T:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

SCOPe Domain Coordinates for d1rzrt_:

Click to download the PDB-style file with coordinates for d1rzrt_.
(The format of our PDB-style files is described here.)

Timeline for d1rzrt_: