SCOPe 2.08: Domain d1rzrd2: 1rzr D:61-332

Lineage for d1rzrd2 (1rzr D:61-332)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d1rzrd2: 1rzr D:61-332 [111994]
   Other proteins in same PDB: d1rzra1, d1rzrc1, d1rzrd1, d1rzrg1, d1rzrl_, d1rzrs_, d1rzrt_, d1rzry_
   protein/DNA complex; complexed with mg, so4

Details for d1rzrd2

PDB Entry: 1rzr, 2.8 Å

PDB Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex

PDB Compounds: (D:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1rzrd2:

Sequence; same for both SEQRES and ATOM records:

>d1rzrd2 c.93.1.1 (D:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivqlphriefrqstk

Timeline for d1rzrd2:

• d1rzrd2 first appeared in SCOP 1.71
  
• d1rzrd2 appears in SCOPe 2.07