SCOPe 2.08: Domain d1wf4l3: 1wf4 l:139-189,l:374-408

Lineage for d1wf4l3 (1wf4 l:139-189,l:374-408)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)

6. Protein GroEL, I domain [54851] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
   Uniprot P61491

8. Domain d1wf4l3: 1wf4 l:139-189,l:374-408 [109375]
   Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4b1, d1wf4b2, d1wf4c1, d1wf4c2, d1wf4d1, d1wf4d2, d1wf4e1, d1wf4e2, d1wf4f1, d1wf4f2, d1wf4g1, d1wf4g2, d1wf4h1, d1wf4h2, d1wf4i1, d1wf4i2, d1wf4j1, d1wf4j2, d1wf4k1, d1wf4k2, d1wf4l1, d1wf4l2, d1wf4m1, d1wf4m2, d1wf4n1, d1wf4n2, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
   complexed with adp, dms, mg
   complexed with adp, dms, mg

Details for d1wf4l3

PDB Entry: 1wf4, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (l:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4l3:

Sequence; same for both SEQRES and ATOM records:

>d1wf4l3 d.56.1.1 (l:139-189,l:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

Timeline for d1wf4l3:

• d1wf4l3 first appeared in SCOP 1.69
  
• d1wf4l3 appears in SCOPe 2.07