Lineage for d1wf4c3 (1wf4 c:139-189,c:374-408)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516356Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2516357Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2516358Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 2516359Protein GroEL, I domain [54851] (4 species)
  7. 2516512Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
    Uniprot P61491
  8. 2516515Domain d1wf4c3: 1wf4 c:139-189,c:374-408 [109348]
    Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4b1, d1wf4b2, d1wf4c1, d1wf4c2, d1wf4d1, d1wf4d2, d1wf4e1, d1wf4e2, d1wf4f1, d1wf4f2, d1wf4g1, d1wf4g2, d1wf4h1, d1wf4h2, d1wf4i1, d1wf4i2, d1wf4j1, d1wf4j2, d1wf4k1, d1wf4k2, d1wf4l1, d1wf4l2, d1wf4m1, d1wf4m2, d1wf4n1, d1wf4n2, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1wf4c3

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (c:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4c3 d.56.1.1 (c:139-189,c:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

SCOPe Domain Coordinates for d1wf4c3:

Click to download the PDB-style file with coordinates for d1wf4c3.
(The format of our PDB-style files is described here.)

Timeline for d1wf4c3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_