Lineage for d1wf4b1 (1wf4 b:3-138,b:409-527)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011121Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2011122Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2011123Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2011124Protein GroEL, E domain [48594] (4 species)
  7. 2011277Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries)
    Uniprot P61491
  8. 2011279Domain d1wf4b1: 1wf4 b:3-138,b:409-527 [109343]
    Other proteins in same PDB: d1wf4a2, d1wf4a3, d1wf4b2, d1wf4b3, d1wf4c2, d1wf4c3, d1wf4d2, d1wf4d3, d1wf4e2, d1wf4e3, d1wf4f2, d1wf4f3, d1wf4g2, d1wf4g3, d1wf4h2, d1wf4h3, d1wf4i2, d1wf4i3, d1wf4j2, d1wf4j3, d1wf4k2, d1wf4k3, d1wf4l2, d1wf4l3, d1wf4m2, d1wf4m3, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1wf4b1

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (b:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4b1 a.129.1.1 (b:3-138,b:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp

SCOPe Domain Coordinates for d1wf4b1:

Click to download the PDB-style file with coordinates for d1wf4b1.
(The format of our PDB-style files is described here.)

Timeline for d1wf4b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wf4a1, d1wf4a2, d1wf4a3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_