Lineage for d1wf4n2 (1wf4 n:190-373)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. Protein GroEL, A domain [52031] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries)
    Uniprot P61491
  8. Domain d1wf4n2: 1wf4 n:190-373 [109380]
    Other proteins in same PDB: d1wf4a1, d1wf4a3, d1wf4b1, d1wf4b3, d1wf4c1, d1wf4c3, d1wf4d1, d1wf4d3, d1wf4e1, d1wf4e3, d1wf4f1, d1wf4f3, d1wf4g1, d1wf4g3, d1wf4h1, d1wf4h3, d1wf4i1, d1wf4i3, d1wf4j1, d1wf4j3, d1wf4k1, d1wf4k3, d1wf4l1, d1wf4l3, d1wf4m1, d1wf4m3, d1wf4n1, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1wf4n2

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (n:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4n2 c.8.5.1 (n:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag

SCOPe Domain Coordinates for d1wf4n2 are not available.

Timeline for d1wf4n2: