PDB entry 1wf4

View 1wf4 on RCSB PDB site
Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
Class: chaperone
Keywords: chaperonin, chaperone, groel, groes, cpn60, cpn10, hsp60, hsp10, folding, ADP, ATP
Deposited on 2004-05-25, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'a':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4a1, d1wf4a2, d1wf4a3
  • Chain 'b':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4b1, d1wf4b2, d1wf4b3
  • Chain 'c':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4c1, d1wf4c2, d1wf4c3
  • Chain 'd':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4d1, d1wf4d2, d1wf4d3
  • Chain 'e':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4e1, d1wf4e2, d1wf4e3
  • Chain 'f':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4f1, d1wf4f2, d1wf4f3
  • Chain 'g':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4g1, d1wf4g2, d1wf4g3
  • Chain 'h':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4h1, d1wf4h2, d1wf4h3
  • Chain 'i':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4i1, d1wf4i2, d1wf4i3
  • Chain 'j':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4j1, d1wf4j2, d1wf4j3
  • Chain 'k':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4k1, d1wf4k2, d1wf4k3
  • Chain 'l':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4l1, d1wf4l2, d1wf4l3
  • Chain 'm':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4m1, d1wf4m2, d1wf4m3
  • Chain 'n':
    Compound: cpn60(GroEL)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4n1, d1wf4n2, d1wf4n3
  • Chain 'o':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4o_
  • Chain 'p':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4p_
  • Chain 'q':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4q_
  • Chain 'r':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4r_
  • Chain 's':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4s_
  • Chain 't':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4t_
  • Chain 'u':
    Compound: cpn10(GroES)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wf4u_
  • Heterogens: MG, ADP, DMS

PDB Chain Sequences:

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >1wf4a (a:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4a (a:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >1wf4b (b:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4b (b:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >1wf4c (c:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4c (c:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'd':
    Sequence, based on SEQRES records: (download)
    >1wf4d (d:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4d (d:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >1wf4e (e:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4e (e:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >1wf4f (f:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4f (f:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >1wf4g (g:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4g (g:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >1wf4h (h:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4h (h:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >1wf4i (i:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4i (i:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >1wf4j (j:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4j (j:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'k':
    Sequence, based on SEQRES records: (download)
    >1wf4k (k:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4k (k:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >1wf4l (l:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4l (l:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'm':
    Sequence, based on SEQRES records: (download)
    >1wf4m (m:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4m (m:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'n':
    Sequence, based on SEQRES records: (download)
    >1wf4n (n:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4n (n:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >1wf4o (o:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4o (o:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'p':
    Sequence, based on SEQRES records: (download)
    >1wf4p (p:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4p (p:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'q':
    Sequence, based on SEQRES records: (download)
    >1wf4q (q:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4q (q:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'r':
    Sequence, based on SEQRES records: (download)
    >1wf4r (r:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4r (r:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 's':
    Sequence, based on SEQRES records: (download)
    >1wf4s (s:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4s (s:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 't':
    Sequence, based on SEQRES records: (download)
    >1wf4t (t:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4t (t:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'u':
    Sequence, based on SEQRES records: (download)
    >1wf4u (u:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4u (u:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq