Lineage for d1wf4e1 (1wf4 e:3-138,e:409-527)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. Protein GroEL, E domain [48594] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries)
    Uniprot P61491
  8. Domain d1wf4e1: 1wf4 e:3-138,e:409-527 [109352]
    Other proteins in same PDB: d1wf4a2, d1wf4a3, d1wf4b2, d1wf4b3, d1wf4c2, d1wf4c3, d1wf4d2, d1wf4d3, d1wf4e2, d1wf4e3, d1wf4f2, d1wf4f3, d1wf4g2, d1wf4g3, d1wf4h2, d1wf4h3, d1wf4i2, d1wf4i3, d1wf4j2, d1wf4j3, d1wf4k2, d1wf4k3, d1wf4l2, d1wf4l3, d1wf4m2, d1wf4m3, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1wf4e1

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (e:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4e1 a.129.1.1 (e:3-138,e:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp

SCOPe Domain Coordinates for d1wf4e1 are not available.

Timeline for d1wf4e1: