SCOPe 2.08: Domain d1w3ba_: 1w3b A:

Lineage for d1w3ba_ (1w3b A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein O-GlcNAc transferase, OGT [109973] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109974] (1 PDB entry)
   Uniprot O15294 16-400

8. Domain d1w3ba_: 1w3b A: [109149]
   complexed with ca
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1w3ba_

PDB Entry: 1w3b, 2.85 Å

PDB Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.

PDB Compounds: (A:) udp-n-acetylglucosamine--peptide n-acetylglucosaminyltransferase 110

SCOPe Domain Sequences for d1w3ba_:

Sequence; same for both SEQRES and ATOM records:

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase, OGT {Human (Homo sapiens) [TaxId: 9606]}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
hykeairisptfadaysnmgntlkemqd

Timeline for d1w3ba_:

• d1w3ba_ first appeared in SCOP 1.69
  
• d1w3ba_ appears in SCOPe 2.07