PDB entry 1w3b

View 1w3b on RCSB PDB site
Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.
Class: transferase
Keywords: ogt, glcnac, nucleoporin, o-linked glycosylation, tpr repeat, protein binding, signal transduction, transferase
Deposited on 2004-07-14, released 2004-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2594
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine--peptide n-acetylglucosaminyltransferase 110
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3B (0-2)
    • Uniprot O15294 (3-387)
    Domains in SCOPe 2.07: d1w3ba_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine--peptide n-acetylglucosaminyltransferase 110
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W3B (0-2)
    • Uniprot O15294 (3-387)
    Domains in SCOPe 2.07: d1w3bb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w3bA (A:)
    gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
    kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
    vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
    aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
    gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
    cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
    hykeairisptfadaysnmgntlkemqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3bB (B:)
    gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
    kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
    vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
    aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
    gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
    cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
    hykeairisptfadaysnmgntlkemqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3bB (B:)
    gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
    kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
    vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
    aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
    gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
    cpthadsyrkalevfpefaaahsnlasvlqqqgklqealmhykeairisptfadaysnmg
    ntlkemqd