Lineage for d1w3bb_ (1w3b B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. Protein O-GlcNAc transferase, OGT [109973] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [109974] (1 PDB entry)
    Uniprot O15294 16-400
  8. Domain d1w3bb_: 1w3b B: [109150]
    complexed with ca
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1w3bb_

PDB Entry: 1w3b (more details), 2.85 Å

PDB Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.
PDB Compounds: (B:) udp-n-acetylglucosamine--peptide n-acetylglucosaminyltransferase 110

SCOPe Domain Sequences for d1w3bb_:

Sequence, based on SEQRES records: (download)

>d1w3bb_ a.118.8.1 (B:) O-GlcNAc transferase, OGT {Human (Homo sapiens) [TaxId: 9606]}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
hykeairisptfadaysnmgntlkemqd

Sequence, based on observed residues (ATOM records): (download)

>d1w3bb_ a.118.8.1 (B:) O-GlcNAc transferase, OGT {Human (Homo sapiens) [TaxId: 9606]}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadsyrkalevfpefaaahsnlasvlqqqgklqealmhykeairisptfadaysnmg
ntlkemqd

SCOPe Domain Coordinates for d1w3bb_ are not available.

Timeline for d1w3bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w3ba_