Lineage for d1w3ba_ (1w3b A:)
- Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds) 
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (2 families) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (11 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein O-GlcNAc transferase p110 subunit, OGT [109973] (1 species) Species Human (Homo sapiens) [TaxId:9606] [109974] (1 PDB entry) 
Domain d1w3ba_: 1w3b A: [109149]
Details for d1w3ba_
PDB Entry: 1w3b (more details), 2.85 Å
PDB Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.
SCOP Domain Sequences for d1w3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens)}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
hykeairisptfadaysnmgntlkemqd
SCOP Domain Coordinates for d1w3ba_:
Click to download the PDB-style file with coordinates for d1w3ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w3ba_:
- d1w3ba_ is new in SCOP 1.69
- d1w3ba_ appears in SCOP 1.71
- d1w3ba_ appears in the current release, SCOPe 2.08
View in 3D
