Lineage for d1w3ba_ (1w3b A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447406Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 447731Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 447732Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (11 proteins)
  6. 447766Protein O-GlcNAc transferase p110 subunit, OGT [109973] (1 species)
  7. 447767Species Human (Homo sapiens) [TaxId:9606] [109974] (1 PDB entry)
  8. 447768Domain d1w3ba_: 1w3b A: [109149]

Details for d1w3ba_

PDB Entry: 1w3b (more details), 2.85 Å

PDB Description: the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha.

SCOP Domain Sequences for d1w3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens)}
gpmelahreyqagdfeaaerhcmqlwrqepdntgvllllssihfqcrrldrsahfstlai
kqnpllaeaysnlgnvykergqlqeaiehyrhalrlkpdfidgyinlaaalvaagdmega
vqayvsalqynpdlycvrsdlgnllkalgrleeakacylkaietqpnfavawsnlgcvfn
aqgeiwlaihhfekavtldpnfldayinlgnvlkearifdravaaylralslspnhavvh
gnlacvyyeqglidlaidtyrraielqphfpdaycnlanalkekgsvaeaedcyntalrl
cpthadslnnlanikreqgnieeavrlyrkalevfpefaaahsnlasvlqqqgklqealm
hykeairisptfadaysnmgntlkemqd

SCOP Domain Coordinates for d1w3ba_:

Click to download the PDB-style file with coordinates for d1w3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1w3ba_: