Lineage for d1tz0b_ (1tz0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949820Family d.58.4.5: PG130-like [102959] (6 proteins)
    subfamily of Pfam PF03992
  6. 2949821Protein Hypothetical protein BC2969 [110957] (1 species)
  7. 2949822Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry)
    Uniprot Q81C15
  8. 2949824Domain d1tz0b_: 1tz0 B: [107464]
    Structural genomics target
    complexed with edo, fmt

Details for d1tz0b_

PDB Entry: 1tz0 (more details), 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1tz0b_:

Sequence, based on SEQRES records: (download)

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaa

Sequence, based on observed residues (ATOM records): (download)

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlagpdhiinvdhavyyvksskaa

SCOPe Domain Coordinates for d1tz0b_:

Click to download the PDB-style file with coordinates for d1tz0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tz0b_: