![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.5: PG130-like [102959] (6 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein BC2969 [110957] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry) Uniprot Q81C15 |
![]() | Domain d1tz0b_: 1tz0 B: [107464] Structural genomics target complexed with edo, fmt |
PDB Entry: 1tz0 (more details), 1.84 Å
SCOPe Domain Sequences for d1tz0b_:
Sequence, based on SEQRES records: (download)
>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]} gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaa
>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]} gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe seeawknwetseehlagpdhiinvdhavyyvksskaa
Timeline for d1tz0b_: