SCOPe 2.08: Domain d1tz0c_: 1tz0 C:

Lineage for d1tz0c_ (1tz0 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein BC2969 [110957] (1 species)

7. Species Bacillus cereus [TaxId:1396] [110958] (1 PDB entry)
   Uniprot Q81C15

8. Domain d1tz0c_: 1tz0 C: [107465]
   Structural genomics target
   complexed with edo, fmt

Details for d1tz0c_

PDB Entry: 1tz0, 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d1tz0c_:

Sequence, based on SEQRES records:

>d1tz0c_ d.58.4.5 (C:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]}
ymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwes
eeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqq

Sequence, based on observed residues (ATOM records):

>d1tz0c_ d.58.4.5 (C:) Hypothetical protein BC2969 {Bacillus cereus [TaxId: 1396]}
ymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwes
eeawknwetseehlgkpkpdhiinvdhavyyvksskaayqq

Timeline for d1tz0c_:

• d1tz0c_ first appeared in SCOP 1.69
  
• d1tz0c_ appears in SCOPe 2.07