Lineage for d1tz0b_ (1tz0 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504226Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 504291Family d.58.4.5: PG130-like [102959] (3 proteins)
    subfamily of Pfam 03992
  6. 504292Protein Hypothetical protein BC2969 [110957] (1 species)
  7. 504293Species Bacillus cereus # Taxonomy ID: 1396; strain ATCC 14579 / DSM 31 [110958] (1 PDB entry)
  8. 504295Domain d1tz0b_: 1tz0 B: [107464]

Details for d1tz0b_

PDB Entry: 1tz0 (more details), 1.84 Å

PDB Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus

SCOP Domain Sequences for d1tz0b_:

Sequence, based on SEQRES records: (download)

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus # Taxonomy ID: 1396; strain ATCC 14579 / DSM 31}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaa

Sequence, based on observed residues (ATOM records): (download)

>d1tz0b_ d.58.4.5 (B:) Hypothetical protein BC2969 {Bacillus cereus # Taxonomy ID: 1396; strain ATCC 14579 / DSM 31}
gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
seeawknwetseehlagpdhiinvdhavyyvksskaa

SCOP Domain Coordinates for d1tz0b_:

Click to download the PDB-style file with coordinates for d1tz0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tz0b_: