PDB entry 1tz0

View 1tz0 on RCSB PDB site
Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, MCSG, Hypothetical Protein, Bacillus cereus, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-07-09, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81C15
      • modified residue (6)
      • modified residue (59)
    Domains in SCOPe 2.07: d1tz0a_
  • Chain 'B':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81C15
      • modified residue (6)
      • modified residue (59)
    Domains in SCOPe 2.07: d1tz0b_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81C15
      • modified residue (6)
      • modified residue (59)
    Domains in SCOPe 2.07: d1tz0c_
  • Heterogens: EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz0A (A:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0A (A:)
    gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
    seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz0B (B:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0B (B:)
    gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
    seeawknwetseehlagpdhiinvdhavyyvksskaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tz0C (C:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0C (C:)
    ymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwes
    eeawknwetseehlgkpkpdhiinvdhavyyvksskaayqq