Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.3: YbeA-like [82371] (5 proteins) Pfam PF02590 |
Protein Hypothetical protein YydA [110497] (1 species) |
Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry) Uniprot Q45601 |
Domain d1to0e_: 1to0 E: [107157] |
PDB Entry: 1to0 (more details), 2.5 Å
SCOPe Domain Sequences for d1to0e_:
Sequence, based on SEQRES records: (download)
>d1to0e_ c.116.1.3 (E:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]} mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr adeklsfskmtfphqlmrlilveqiyrafrinr
>d1to0e_ c.116.1.3 (E:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]} mninivtigklkekylkqgieeytkrlsayakidiielpdikdkegdrilskispdahvi alaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtfph qlmrlilveqiyrafrinr
Timeline for d1to0e_: