PDB entry 1to0

View 1to0 on RCSB PDB site
Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-06-11, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0a_
  • Chain 'B':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0b_
  • Chain 'C':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0c_
  • Chain 'D':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0d_
  • Chain 'E':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0e_
  • Chain 'F':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0f_
  • Chain 'G':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0g_
  • Chain 'H':
    Compound: Hypothetical UPF0247 protein yyda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YYDA, BSU40230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45601 (0-End)
      • modified residue (0)
      • modified residue (51)
      • modified residue (81)
      • modified residue (117)
      • modified residue (129)
      • modified residue (136)
    Domains in SCOPe 2.07: d1to0h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1to0A (A:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0A (A:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekmkiikdkegdrilskisp
    dahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfsk
    mtfphqlmrlilveqiyrafrinrgepy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1to0B (B:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0B (B:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdedmkiikdkegdrilskisp
    dahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfsk
    mtfphqlmrlilveqiyrafrinrgepy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1to0C (C:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0C (C:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekqdmkiikdkegdrilski
    spdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsf
    skmtfphqlmrlilveqiyrafrinrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1to0D (D:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0D (D:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdlsdqdmkiikdkegdrilsk
    ispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradekls
    fskmtfphqlmrlilveqiyrafrinrgepy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1to0E (E:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0E (E:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdikdkegdrilskispdahvi
    alaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtfph
    qlmrlilveqiyrafrinr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1to0F (F:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0F (F:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdkiikdkegdrilskispdah
    vialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtf
    phqlmrlilveqiyrafrinrg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1to0G (G:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0G (G:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdedmkiikdkegdrilskisp
    dahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfsk
    mtfphqlmrlilveqiyrafrinrgepy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1to0H (H:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
    drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
    adeklsfskmtfphqlmrlilveqiyrafrinrgepyhklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to0H (H:)
    mninivtigklkekylkqgieeytkrlsayakidiielpdekqdmkiikdkegdrilski
    spdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsf
    skmtfphqlmrlilveqiyrafrinrgepy