Lineage for d1to0f_ (1to0 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921250Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 2921266Protein Hypothetical protein YydA [110497] (1 species)
  7. 2921267Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry)
    Uniprot Q45601
  8. 2921273Domain d1to0f_: 1to0 F: [107158]

Details for d1to0f_

PDB Entry: 1to0 (more details), 2.5 Å

PDB Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis
PDB Compounds: (F:) Hypothetical UPF0247 protein yyda

SCOPe Domain Sequences for d1to0f_:

Sequence, based on SEQRES records: (download)

>d1to0f_ c.116.1.3 (F:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]}
mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
adeklsfskmtfphqlmrlilveqiyrafrinrg

Sequence, based on observed residues (ATOM records): (download)

>d1to0f_ c.116.1.3 (F:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]}
mninivtigklkekylkqgieeytkrlsayakidiielpdkiikdkegdrilskispdah
vialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtf
phqlmrlilveqiyrafrinrg

SCOPe Domain Coordinates for d1to0f_:

Click to download the PDB-style file with coordinates for d1to0f_.
(The format of our PDB-style files is described here.)

Timeline for d1to0f_: