Lineage for d1to0e_ (1to0 E:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496141Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 496142Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 496169Family c.116.1.3: YbeA-like [82371] (4 proteins)
    Pfam 02590
  6. 496185Protein Hypothetical protein YydA [110497] (1 species)
  7. 496186Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry)
  8. 496191Domain d1to0e_: 1to0 E: [107157]

Details for d1to0e_

PDB Entry: 1to0 (more details), 2.5 Å

PDB Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis

SCOP Domain Sequences for d1to0e_:

Sequence, based on SEQRES records: (download)

>d1to0e_ c.116.1.3 (E:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
adeklsfskmtfphqlmrlilveqiyrafrinr

Sequence, based on observed residues (ATOM records): (download)

>d1to0e_ c.116.1.3 (E:) Hypothetical protein YydA {Bacillus subtilis}
mninivtigklkekylkqgieeytkrlsayakidiielpdikdkegdrilskispdahvi
alaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtfph
qlmrlilveqiyrafrinr

SCOP Domain Coordinates for d1to0e_:

Click to download the PDB-style file with coordinates for d1to0e_.
(The format of our PDB-style files is described here.)

Timeline for d1to0e_: