SCOPe 2.08: Domain d1to0g_: 1to0 G:

Lineage for d1to0g_ (1to0 G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (5 proteins)
   Pfam PF02590

6. Protein Hypothetical protein YydA [110497] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110498] (1 PDB entry)
   Uniprot Q45601

8. Domain d1to0g_: 1to0 G: [107159]

Details for d1to0g_

PDB Entry: 1to0, 2.5 Å

PDB Description: X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis

PDB Compounds: (G:) Hypothetical UPF0247 protein yyda

SCOPe Domain Sequences for d1to0g_:

Sequence, based on SEQRES records:

>d1to0g_ c.116.1.3 (G:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]}
mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkeg
drilskispdahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkr
adeklsfskmtfphqlmrlilveqiyrafrinrgepy

Sequence, based on observed residues (ATOM records):

>d1to0g_ c.116.1.3 (G:) Hypothetical protein YydA {Bacillus subtilis [TaxId: 1423]}
mninivtigklkekylkqgieeytkrlsayakidiielpdedmkiikdkegdrilskisp
dahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfsk
mtfphqlmrlilveqiyrafrinrgepy

Timeline for d1to0g_:

• d1to0g_ first appeared in SCOP 1.69
  
• d1to0g_ appears in SCOPe 2.07