Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Transhydroxylase alpha subunit, AthL [110250] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries) Uniprot P80563 |
Domain d1ti6c1: 1ti6 C:729-875 [106978] Other proteins in same PDB: d1ti6a2, d1ti6b1, d1ti6b2, d1ti6c2, d1ti6d1, d1ti6d2, d1ti6e2, d1ti6f1, d1ti6f2, d1ti6g2, d1ti6h1, d1ti6h2, d1ti6i2, d1ti6j1, d1ti6j2, d1ti6k2, d1ti6l1, d1ti6l2 complexed with 4mo, btt, ca, mgd, sf4 complexed with 4mo, btt, ca, mgd, sf4 |
PDB Entry: 1ti6 (more details), 2 Å
SCOPe Domain Sequences for d1ti6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti6c1 b.52.2.2 (C:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi skyacgmanntalveiekwdgdkyeiy
Timeline for d1ti6c1: