Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) |
Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) Uniprot P80564 |
Domain d1ti6b1: 1ti6 B:196-274 [106976] Other proteins in same PDB: d1ti6a1, d1ti6a2, d1ti6b2, d1ti6c1, d1ti6c2, d1ti6d2, d1ti6e1, d1ti6e2, d1ti6f2, d1ti6g1, d1ti6g2, d1ti6h2, d1ti6i1, d1ti6i2, d1ti6j2, d1ti6k1, d1ti6k2, d1ti6l2 complexed with 4mo, btt, ca, mgd, sf4 complexed with 4mo, btt, ca, mgd, sf4 |
PDB Entry: 1ti6 (more details), 2 Å
SCOPe Domain Sequences for d1ti6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti6b1 b.3.5.1 (B:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1ti6b1: