Lineage for d1ti6j2 (1ti6 J:1-195)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949395Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 2949396Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 2949407Domain d1ti6j2: 1ti6 J:1-195 [106993]
    Other proteins in same PDB: d1ti6a1, d1ti6a2, d1ti6b1, d1ti6c1, d1ti6c2, d1ti6d1, d1ti6e1, d1ti6e2, d1ti6f1, d1ti6g1, d1ti6g2, d1ti6h1, d1ti6i1, d1ti6i2, d1ti6j1, d1ti6k1, d1ti6k2, d1ti6l1
    complexed with 4mo, btt, ca, mgd, sf4
    complexed with 4mo, btt, ca, mgd, sf4

Details for d1ti6j2

PDB Entry: 1ti6 (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
PDB Compounds: (J:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti6j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti6j2 d.58.1.5 (J:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOPe Domain Coordinates for d1ti6j2:

Click to download the PDB-style file with coordinates for d1ti6j2.
(The format of our PDB-style files is described here.)

Timeline for d1ti6j2: