Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) Uniprot P80564 |
Domain d1ti6d2: 1ti6 D:1-195 [106981] Other proteins in same PDB: d1ti6a1, d1ti6a2, d1ti6b1, d1ti6c1, d1ti6c2, d1ti6d1, d1ti6e1, d1ti6e2, d1ti6f1, d1ti6g1, d1ti6g2, d1ti6h1, d1ti6i1, d1ti6i2, d1ti6j1, d1ti6k1, d1ti6k2, d1ti6l1 complexed with 4mo, btt, ca, mgd, sf4 complexed with 4mo, btt, ca, mgd, sf4 |
PDB Entry: 1ti6 (more details), 2 Å
SCOPe Domain Sequences for d1ti6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti6d2 d.58.1.5 (D:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel gtkprvyyknlyrfe
Timeline for d1ti6d2: