Lineage for d1ti6c1 (1ti6 C:729-875)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467244Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)
  7. 467245Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
  8. 467247Domain d1ti6c1: 1ti6 C:729-875 [106978]
    Other proteins in same PDB: d1ti6a2, d1ti6b1, d1ti6b2, d1ti6c2, d1ti6d1, d1ti6d2, d1ti6e2, d1ti6f1, d1ti6f2, d1ti6g2, d1ti6h1, d1ti6h2, d1ti6i2, d1ti6j1, d1ti6j2, d1ti6k2, d1ti6l1, d1ti6l2

Details for d1ti6c1

PDB Entry: 1ti6 (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1ti6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti6c1 b.52.2.2 (C:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

SCOP Domain Coordinates for d1ti6c1:

Click to download the PDB-style file with coordinates for d1ti6c1.
(The format of our PDB-style files is described here.)

Timeline for d1ti6c1: