SCOPe 2.08: Domain d1t9gc1: 1t9g C:242-395

Lineage for d1t9gc1 (1t9g C:242-395)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
   Uniprot P11310 34-421

8. Domain d1t9gc1: 1t9g C:242-395 [106715]
   Other proteins in same PDB: d1t9ga2, d1t9gb2, d1t9gc2, d1t9gd2, d1t9gr_, d1t9gs_
   complexed with amp, fad

Details for d1t9gc1

PDB Entry: 1t9g, 2.9 Å

PDB Description: Structure of the human MCAD:ETF complex

PDB Compounds: (C:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial

SCOPe Domain Sequences for d1t9gc1:

Sequence; same for both SEQRES and ATOM records:

>d1t9gc1 a.29.3.1 (C:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

Timeline for d1t9gc1:

• d1t9gc1 first appeared in SCOP 1.69
  
• d1t9gc1 appears in SCOPe 2.07