Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1t9gd2 (1t9g D:10-241)

  1. Root: SCOP 1.75B
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 protein domains)
  6. Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
    Uniprot P11310 34-421
  8. Domain d1t9gd2: 1t9g D:10-241 [106718]
    Other proteins in same PDB: d1t9ga1, d1t9gb1, d1t9gc1, d1t9gd1, d1t9gr_, d1t9gs_
    complexed with amp, fad

Details for d1t9gd2

PDB Entry: 1t9g (more details)
PDB Description: structure of the human mcad:etf complex
PDB Compounds: (D:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial

SCOP Domain Sequences for d1t9gd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9gd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1t9gd2:

Click to download the PDB-style file with coordinates for d1t9gd2.
(The format of our PDB-style files is described here.)

Timeline for d1t9gd2:

d1t9gd2 appears in SCOP 1.75A


d1t9gd2
(click for larger image)


d1t9gd2 in context of chain
Domains from same chain:
d1t9gd1


d1t9gd2 in context of PDB
Domains from other chains:
d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gr_, d1t9gs_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu