Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1t9gr_ (1t9g R:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. Family c.26.2.3: ETFP subunits [52432] (3 protein domains)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries)
    Uniprot P13804 20-203
  8. Domain d1t9gr_: 1t9g R: [106719]
    Other proteins in same PDB: d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gd1, d1t9gd2, d1t9gs_
    only the N-terminal domain is ordered in the crystal
    complexed with amp, fad

Details for d1t9gr_

PDB Entry: 1t9g (more details)
PDB Description: structure of the human mcad:etf complex
PDB Compounds: (R:) Electron transfer flavoprotein alpha-subunit, mitochondrial

SCOP Domain Sequences for d1t9gr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9gr_ c.26.2.3 (R:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqk

SCOP Domain Coordinates for d1t9gr_:

Click to download the PDB-style file with coordinates for d1t9gr_.
(The format of our PDB-style files is described here.)

Timeline for d1t9gr_:

d1t9gr_ appears in SCOP 1.75A


d1t9gr_
(click for larger image)


d1t9gr_ in context of chain



d1t9gr_ in context of PDB
Domains from other chains:
d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gd1, d1t9gd2, d1t9gs_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu