Lineage for d1t6ul_ (1t6u L:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries)
    Uniprot P80735
  8. Domain d1t6ul_: 1t6u L: [106595]
    complexed with ni

Details for d1t6ul_

PDB Entry: 1t6u (more details), 1.3 Å

PDB Description: Nickel Superoxide Dismutase (NiSOD) Native 1.30 A Structure
PDB Compounds: (L:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1t6ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6ul_ a.24.22.1 (L:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]}
hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk

SCOPe Domain Coordinates for d1t6ul_ are not available.

Timeline for d1t6ul_:

Domains from other chains:
(mouse over for more information)
d1t6ua_, d1t6ub_, d1t6uc_, d1t6ud_, d1t6ue_, d1t6uf_, d1t6ug_, d1t6uh_, d1t6ui_, d1t6uj_, d1t6uk_