Lineage for d1t6ue_ (1t6u E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700648Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. 2700649Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. 2700650Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 2700651Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries)
    Uniprot P80735
  8. 2700656Domain d1t6ue_: 1t6u E: [106588]
    complexed with ni

Details for d1t6ue_

PDB Entry: 1t6u (more details), 1.3 Å

PDB Description: nickel superoxide dismutase (nisod) native 1.30 a structure
PDB Compounds: (E:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1t6ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6ue_ a.24.22.1 (E:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]}
hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk

SCOPe Domain Coordinates for d1t6ue_:

Click to download the PDB-style file with coordinates for d1t6ue_.
(The format of our PDB-style files is described here.)

Timeline for d1t6ue_: