![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) ![]() automatically mapped to Pfam PF09055 |
![]() | Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
![]() | Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries) Uniprot P80735 |
![]() | Domain d1t6ui_: 1t6u I: [106592] complexed with ni |
PDB Entry: 1t6u (more details), 1.3 Å
SCOPe Domain Sequences for d1t6ui_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ui_ a.24.22.1 (I:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]} hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
Timeline for d1t6ui_: