PDB entry 1t6u

View 1t6u on RCSB PDB site
Description: Nickel Superoxide Dismutase (NiSOD) Native 1.30 A Structure
Class: oxidoreductase
Keywords: Nickel, 4-helix bundle, hexamer, superoxide dismutase, NiSOD, SOD, high resolution, oxidoreductase
Deposited on 2004-05-07, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ua_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ub_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6uc_
  • Chain 'D':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ud_
  • Chain 'E':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ue_
  • Chain 'F':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6uf_
  • Chain 'G':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ug_
  • Chain 'H':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6uh_
  • Chain 'I':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ui_
  • Chain 'J':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6uj_
  • Chain 'K':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6uk_
  • Chain 'L':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (84)
    Domains in SCOPe 2.08: d1t6ul_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uA (A:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uB (B:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uC (C:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t6uD (D:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uD (D:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t6uE (E:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uE (E:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t6uF (F:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uF (F:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uG (G:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1t6uH (H:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uH (H:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uI (I:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6uJ (J:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1t6uK (K:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uK (K:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1t6uL (L:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6uL (L:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk