Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Quinoline 2-oxidoreductase medium subunit QorM [111061] (1 species) |
Species Pseudomonas putida [TaxId:303] [111062] (1 PDB entry) Uniprot P72222 |
Domain d1t3qc1: 1t3q C:177-285 [106371] Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf2 complexed with fad, fes, gol, mcn, smo, so4 |
PDB Entry: 1t3q (more details), 1.8 Å
SCOPe Domain Sequences for d1t3qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3qc1 d.87.2.1 (C:177-285) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]} hwefdeyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvid estaataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamy
Timeline for d1t3qc1: