Lineage for d1t3qb2 (1t3q B:166-786)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540550Protein Quinoline 2-oxidoreductase large subunit QorL [111178] (1 species)
  7. 2540551Species Pseudomonas putida [TaxId:303] [111179] (1 PDB entry)
    Uniprot P72224
  8. 2540552Domain d1t3qb2: 1t3q B:166-786 [106370]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qf1, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qb2

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (B:) quinoline 2-oxidoreductase large subunit

SCOPe Domain Sequences for d1t3qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qb2 d.133.1.1 (B:166-786) Quinoline 2-oxidoreductase large subunit QorL {Pseudomonas putida [TaxId: 303]}
vsrtsrardelapifassagvvrgqfscgrvsacpmetrgavaqyewttqqlilwtatqm
psfvrtmvamfcaipehlievrvpdvgggfgqkahlhpeellvcllsralgrpvrwiedr
qenflgathakqqrnemglafdgdgrflalenrsitdggaynnlpwtqlveshvgnavil
gvykvpavseesiavatnkcpigayrgvgftagqiaretlidraarqlglspfeirrrnv
vmpedfpftnrlgqthregtylqtinlleemvnpeafrqrqaearargkylglgvsvfne
vtgtgtrtlsflgtpttthdsatvridptgkvtvttslassgqghettlaqiaadvlgvp
asdvviqagstkntygfgayasrgavigagsigraasivrervkqlaghlleaasedivi
edglvhvagvpakgmpfaevvgaayfadathppgfdatleatatydpsdlvlangghaai
veidastyatrvtdffavedcgtminpmivegqirggiaqaigqtlleeviyddfgqlvt
ttlmdylipttldvpdirirhletpsplvpggikgmgesamisapaavvaavndalahle
vvietvpitperifrsiqerp

SCOPe Domain Coordinates for d1t3qb2:

Click to download the PDB-style file with coordinates for d1t3qb2.
(The format of our PDB-style files is described here.)

Timeline for d1t3qb2: