Lineage for d1t3qe1 (1t3q E:1-165)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. Protein Quinoline 2-oxidoreductase large subunit QorL, N-domain [110905] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [110906] (1 PDB entry)
    Uniprot P72224
  8. Domain d1t3qe1: 1t3q E:1-165 [106375]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe2, d1t3qf1, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qe1

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (E:) quinoline 2-oxidoreductase large subunit

SCOPe Domain Sequences for d1t3qe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qe1 d.41.1.1 (E:1-165) Quinoline 2-oxidoreductase large subunit QorL, N-domain {Pseudomonas putida [TaxId: 303]}
mmkhevvalkkksigtsvlrredtrlltgrgryiadlvlsgmlhvaslrspfaharivsi
dvadaqalpgvelvwcgadvaelsqgivatmqvegfqttiqpllangvtrfvgeivavvv
assraiaedaaqliqveyeelpavtgieaalegearandtlagnv

SCOPe Domain Coordinates for d1t3qe1 are not available.

Timeline for d1t3qe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3qe2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qf1, d1t3qf2