Lineage for d1t3qf1 (1t3q F:177-285)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528454Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2528455Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2528479Protein Quinoline 2-oxidoreductase medium subunit QorM [111061] (1 species)
  7. 2528480Species Pseudomonas putida [TaxId:303] [111062] (1 PDB entry)
    Uniprot P72222
  8. 2528482Domain d1t3qf1: 1t3q F:177-285 [106377]
    Other proteins in same PDB: d1t3qa1, d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc2, d1t3qd1, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qf1

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (F:) quinoline 2-oxidoreductase medium subunit

SCOPe Domain Sequences for d1t3qf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qf1 d.87.2.1 (F:177-285) Quinoline 2-oxidoreductase medium subunit QorM {Pseudomonas putida [TaxId: 303]}
hwefdeyarrkgdyalvmaaaglsmqggrcvaarialgaveerahqairandflvgkvid
estaataaelategleprsdihgsrdlrlslakaitqrvilkaaqgamy

SCOPe Domain Coordinates for d1t3qf1:

Click to download the PDB-style file with coordinates for d1t3qf1.
(The format of our PDB-style files is described here.)

Timeline for d1t3qf1: