Lineage for d1t3qa1 (1t3q A:88-168)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715297Protein Quinoline 2-oxidoreductase small subunit QorS, C-domain [109849] (1 species)
  7. 2715298Species Pseudomonas putida [TaxId:303] [109850] (1 PDB entry)
    Uniprot P72223
  8. 2715299Domain d1t3qa1: 1t3q A:88-168 [106367]
    Other proteins in same PDB: d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qa1

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (A:) quinoline 2-oxidoreductase small subunit

SCOPe Domain Sequences for d1t3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qa1 a.56.1.1 (A:88-168) Quinoline 2-oxidoreductase small subunit QorS, C-domain {Pseudomonas putida [TaxId: 303]}
qgeklnalqdsfrrhhalqcgfctagmlatarsilaenpapsrdevrevmsgnlcrctgy
etiidaitdpavaeaarrgev

SCOPe Domain Coordinates for d1t3qa1:

Click to download the PDB-style file with coordinates for d1t3qa1.
(The format of our PDB-style files is described here.)

Timeline for d1t3qa1: