Lineage for d1t3qa2 (1t3q A:7-87)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159971Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 protein domains)
  6. 2160068Protein Quinoline 2-oxidoreductase small subunit QorS, N-domain [110808] (1 species)
  7. 2160069Species Pseudomonas putida [TaxId:303] [110809] (1 PDB entry)
    Uniprot P72223
  8. 2160070Domain d1t3qa2: 1t3q A:7-87 [106368]
    Other proteins in same PDB: d1t3qa1, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd1, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2
    complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qa2

PDB Entry: 1t3q (more details), 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86
PDB Compounds: (A:) quinoline 2-oxidoreductase small subunit

SCOPe Domain Sequences for d1t3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]}
sqlmrisatingkprvfyveprmhladalrevvgltgtkigceqgvcgsctilidgapmr
scltlavqaegcsietvegls

SCOPe Domain Coordinates for d1t3qa2:

Click to download the PDB-style file with coordinates for d1t3qa2.
(The format of our PDB-style files is described here.)

Timeline for d1t3qa2: