Lineage for d1st6a7 (1st6 A:719-855)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311768Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2311769Family a.24.9.1: alpha-catenin/vinculin [47221] (3 protein domains)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2311785Protein Vinculin [47224] (2 species)
  7. 2311786Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
    Uniprot P12003
  8. 2311797Domain d1st6a7: 1st6 A:719-855 [106006]
    Other proteins in same PDB: d1st6a9
    full-length protein containing eight four-helix bundle domains

Details for d1st6a7

PDB Entry: 1st6 (more details), 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1st6a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st6a7 a.24.9.1 (A:719-855) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
tkslldaseeaikkdldkckvamanmqpqmlvagatsiarranrillvakrevensedpk
freavkaasdelsktispmvmdakavagnisdpglqksfldsgyrilgavakvreafqpq
epdfpppppdlehlhlt

SCOPe Domain Coordinates for d1st6a7:

Click to download the PDB-style file with coordinates for d1st6a7.
(The format of our PDB-style files is described here.)

Timeline for d1st6a7: