Lineage for d1st6a7 (1st6 A:719-855)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440716Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) (S)
  5. 440717Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 440733Protein Vinculin [47224] (2 species)
  7. 440734Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
  8. 440745Domain d1st6a7: 1st6 A:719-855 [106006]

Details for d1st6a7

PDB Entry: 1st6 (more details), 3.1 Å

PDB Description: Crystal structure of a cytoskeletal protein

SCOP Domain Sequences for d1st6a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st6a7 a.24.9.1 (A:719-855) Vinculin {Chicken (Gallus gallus)}
tkslldaseeaikkdldkckvamanmqpqmlvagatsiarranrillvakrevensedpk
freavkaasdelsktispmvmdakavagnisdpglqksfldsgyrilgavakvreafqpq
epdfpppppdlehlhlt

SCOP Domain Coordinates for d1st6a7:

Click to download the PDB-style file with coordinates for d1st6a7.
(The format of our PDB-style files is described here.)

Timeline for d1st6a7: