Lineage for d1seje2 (1sej E:181-521)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. Species Cryptosporidium hominis [TaxId:237895] [100887] (16 PDB entries)
  8. Domain d1seje2: 1sej E:181-521 [105464]
    Other proteins in same PDB: d1seja1, d1sejb1, d1sejc1, d1sejd1, d1seje1
    Q5CGA3 Q27552
    complexed with f89, ndp, ump

Details for d1seje2

PDB Entry: 1sej (more details), 2.8699999999999997 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump
PDB Compounds: (E:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1seje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seje2 d.117.1.1 (E:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d1seje2 are not available.

Timeline for d1seje2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1seje1
View in 3D
Domains from other chains:
(mouse over for more information)
d1seja1, d1seja2, d1sejb1, d1sejb2, d1sejc1, d1sejc2, d1sejd1, d1sejd2