SCOPe 2.08: Domain d1sejc2: 1sej C:181-521

Lineage for d1sejc2 (1sej C:181-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)

7. Species Cryptosporidium hominis [TaxId:237895] [100887] (16 PDB entries)

8. Domain d1sejc2: 1sej C:181-521 [105460]
   Other proteins in same PDB: d1seja1, d1sejb1, d1sejc1, d1sejd1, d1seje1
   Q5CGA3 Q27552
   complexed with f89, ndp, ump

Details for d1sejc2

PDB Entry: 1sej, 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump

PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1sejc2:

Sequence; same for both SEQRES and ATOM records:

>d1sejc2 d.117.1.1 (C:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

Timeline for d1sejc2:

• d1sejc2 first appeared in SCOP 1.69
  
• d1sejc2 appears in SCOPe 2.07