SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1seja1 (1sej A:3-180)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136823Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2136824Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 2136830Domain d1seja1: 1sej A:3-180 [105455]
    Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2
    complexed with f89, ndp, ump

Details for d1seja1

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: Crystal Structure of Dihydrofolate Reductase-Thymidylate Synthase from Cryptosporidium hominis Bound to 1843U89/NADPH/dUMP
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1seja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d1seja1:

Click to download the PDB-style file with coordinates for d1seja1.
(The format of our PDB-style files is described here.)

Timeline for d1seja1: